Product Browser

Last updated: 2017/1/15
  • Related Product Showcase
  • By Research Area

  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TAF12 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00006883-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human TAF12 protein.
  • Immunogen:
  • TAF12 (AAH11986, 1 a.a. ~ 161 a.a) full-length human protein.
  • Sequence:
  • MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of TAF12 expression in transfected 293T cell line (H00006883-T01) by TAF12 MaxPab polyclonal antibody.

    Lane1:TAF12 transfected lysate(17.82 KDa).
    Lane 2:Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 6883
  • Gene Name:
  • TAF12
  • Gene Alias:
  • TAF2J,TAFII20
  • Gene Description:
  • TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa
  • Gene Summary:
  • Control of transcription by RNA polymerase II involves the basal transcription machinery which is a collection of proteins. These proteins with RNA polymerase II, assemble into complexes which are modulated by transactivator proteins that bind to cis-regulatory elements located adjacent to the transcription start site. Some modulators interact directly with the basal complex, whereas others may act as bridging proteins linking transactivators to the basal transcription factors. Some of these associated factors are weakly attached while others are tightly associated with TBP in the TFIID complex. Among the latter are the TAF proteins. Different TAFs are predicted to mediate the function of distinct transcriptional activators for a variety of gene promoters and RNA polymerases. TAF12 interacts directly with TBP as well as with TAF2I. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000003785,OTTHUMP00000003786,TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20 kD,TATA box binding protein (TBP)-associated factor, RNA polymerase II, J, 20kD,transcription initiation factor TFIID 20/15 kDa subunits
  • RSS
  • YouTube
  • Linkedin
  • Facebook