TAF7 monoclonal antibody (M01), clone 2C5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant TAF7.
Immunogen
TAF7 (AAH32737, 130 a.a. ~ 224 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
FIWNHGITLPLKNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDETKEAENQGLDISSPGMSGHRQGHDSLEHDELREIFN
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.08 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
TAF7 monoclonal antibody (M01), clone 2C5 Western Blot analysis of TAF7 expression in MCF-7 ( Cat # L046V1 ).Western Blot (Transfected lysate)
Western Blot analysis of TAF7 expression in transfected 293T cell line by TAF7 monoclonal antibody (M01), clone 2C5.
Lane 1: TAF7 transfected lysate(40.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TAF7 on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3 ug/ml]Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TAF7 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TAF7 is approximately 0.3ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of TAF7 over-expressed 293 cell line, cotransfected with TAF7 Validated Chimera RNAi ( Cat # H00006879-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with TAF7 monoclonal antibody (M01), clone 2C5 (Cat # H00006879-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to TAF7 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — TAF7
Entrez GeneID
6879GeneBank Accession#
BC032737Protein Accession#
AAH32737Gene Name
TAF7
Gene Alias
TAF2F, TAFII55
Gene Description
TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa
Omim ID
600573Gene Ontology
HyperlinkGene Summary
The intronless gene for this transcription coactivator is located between the protocadherin beta and gamma gene clusters on chromosome 5. The protein encoded by this gene is a component of the TFIID protein complex, a complex which binds to the TATA box in class II promoters and recruits RNA polymerase II and other factors. This particular subunit interacts with the largest TFIID subunit, as well as multiple transcription activators. The protein is required for transcription by promoters targeted by RNA polymerase II. [provided by RefSeq
Other Designations
OTTHUMP00000160028|TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55 kD|TATA box binding protein (TBP)-associated factor, RNA polymerase II, F, 55kD|TATA box-binding protein-associated factor 2F|TBP-associated factor F|transcrip
-
Interactomes
-
Pathways
-
Publication Reference
-
The nuclear transcription factor, TAF7, is a cytoplasmic regulator of protein synthesis.
Dan Cheng, Kevin Semmens, Elizabeth McManus, Qingrong Chen, Daoud Meerzaman, Xiantao Wang, Markus Hafner, Brian A Lewis, Hidehisa Takahashi, Ballachanda N Devaiah, Anne Gegonne, Dinah S Singer.
Science Advances 2021 Dec; 7(50):eabi5751.
Application:IF, IP, IP-WB, WB-Ce, Human, Mouse, Hela, Hela S3 cells, Mouse lymphoma.
-
Core promoter factor TAF9B regulates neuronal gene expression.
Herrera FJ, Yamaguchi T, Roelink H, Tjian R.
ELife 2014 Jul; 3:e02559.
Application:WB-Ce, Mouse, ES cells.
-
Taf7l cooperates with Trf2 to regulate spermiogenesis.
Zhou H, Grubisic I, Zheng K, He Y, Wang PJ, Kaplan T, Tjian R.
PNAS 2013 Oct; 110(42):16886.
Application:WB-Ti, Mouse, Testis.
-
Dual functions of TAF7L in adipocyte differentiation.
Zhou H, Kaplan T, Li Y, Grubisic I, Zhang Z, Wang PJ, Eisen MB, Tjian R.
elife 2013 Jan; 2:e00170.
Application:WB, Mouse, C3H10T1/2 cells.
-
Core promoter recognition complex changes accompany liver development.
D'Alessio JA, Ng R, Willenbring H, Tjian R.
PNAS 2011 Mar; 108(10):3906.
Application:WB-Ce, Mouse, Hepatoblasts, Hepatocytes.
-
The nuclear transcription factor, TAF7, is a cytoplasmic regulator of protein synthesis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com