Product Browser

Last updated: 2017/1/15
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TADA2L monoclonal antibody (M01), clone 4A8-1A7

  • Catalog # : H00006871-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full length recombinant TADA2L.
  • Immunogen:
  • TADA2L (AAH01172, 1 a.a. ~ 305 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MDRLGSFSNDPSDKPPCRGCSSYLMEPYIKCAECGPPPFFLCLQCFTRGFEYKKHRSDHTYEIMTSDFPVLDPSWTAQEEMALLEAVMDCGFGNWQDVANQMCTKTKEECEKHYMKYFINNPLFASTLLNLKQAEEAKTADTAIPFHSTDDPPRPTFDSLLSRDMAGYMPARADFIEEFDNYAEWDLRDIDFVEDDSDILHALKMAVVDIYHSRLKERQRRKKIIRDHGLINLRKFQLMERRYPKEVQDLYETMRRFARIVGPVEHDKFIESHACRWFLSLEQYLCVYIYINRRDNGVFYVKFYK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00006871-M01
    Western Blot detection against Immunogen (59.29 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of TADA2L expression in transfected 293T cell line by TADA2L monoclonal antibody (M01), clone 4A8-1A7.

    Lane 1: TADA2L transfected lysate (Predicted MW: 51.5 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 6871
  • Gene Name:
  • TADA2L
  • Gene Alias:
  • ADA2,ADA2A,FLJ12705,KL04P,hADA2
  • Gene Description:
  • transcriptional adaptor 2 (ADA2 homolog, yeast)-like
  • Gene Summary:
  • Many DNA-binding transcriptional activator proteins enhance the initiation rate of RNA polymerase II-mediated gene transcription by interacting functionally with the general transcription machinery bound at the basal promoter. Adaptor proteins are usually required for this activation, possibly to acetylate and destabilize nucleosomes, thereby relieving chromatin constraints at the promoter. The protein encoded by this gene is a transcriptional activator adaptor and has been found to be part of the PCAF histone acetylase complex. Two transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq
  • Other Designations:
  • ADA2-like,OTTHUMP00000164063,transcriptional adaptor 2 (ADA2, yeast, homolog)-like,transcriptional adaptor 2 alpha,transcriptional adaptor 2-like
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook