TADA2L monoclonal antibody (M01), clone 4A8-1A7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of TADA2L expression in transfected 293T cell line by TADA2L monoclonal antibody (M01), clone 4A8-1A7.
Lane 1: TADA2L transfected lysate (Predicted MW: 51.5 KDa).
Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (59.29 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant TADA2L.
Immunogen
TADA2L (AAH01172, 1 a.a. ~ 305 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MDRLGSFSNDPSDKPPCRGCSSYLMEPYIKCAECGPPPFFLCLQCFTRGFEYKKHRSDHTYEIMTSDFPVLDPSWTAQEEMALLEAVMDCGFGNWQDVANQMCTKTKEECEKHYMKYFINNPLFASTLLNLKQAEEAKTADTAIPFHSTDDPPRPTFDSLLSRDMAGYMPARADFIEEFDNYAEWDLRDIDFVEDDSDILHALKMAVVDIYHSRLKERQRRKKIIRDHGLINLRKFQLMERRYPKEVQDLYETMRRFARIVGPVEHDKFIESHACRWFLSLEQYLCVYIYINRRDNGVFYVKFYK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (95); Rat (95)
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (59.29 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of TADA2L expression in transfected 293T cell line by TADA2L monoclonal antibody (M01), clone 4A8-1A7.
Lane 1: TADA2L transfected lysate (Predicted MW: 51.5 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
-
Gene Info — TADA2L
Entrez GeneID
6871GeneBank Accession#
BC001172Protein Accession#
AAH01172Gene Name
TADA2L
Gene Alias
ADA2, ADA2A, FLJ12705, KL04P, hADA2
Gene Description
transcriptional adaptor 2 (ADA2 homolog, yeast)-like
Omim ID
602276Gene Ontology
HyperlinkGene Summary
Many DNA-binding transcriptional activator proteins enhance the initiation rate of RNA polymerase II-mediated gene transcription by interacting functionally with the general transcription machinery bound at the basal promoter. Adaptor proteins are usually required for this activation, possibly to acetylate and destabilize nucleosomes, thereby relieving chromatin constraints at the promoter. The protein encoded by this gene is a transcriptional activator adaptor and has been found to be part of the PCAF histone acetylase complex. Two transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq
Other Designations
ADA2-like|OTTHUMP00000164063|transcriptional adaptor 2 (ADA2, yeast, homolog)-like|transcriptional adaptor 2 alpha|transcriptional adaptor 2-like
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com