Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SULT1C2 purified MaxPab mouse polyclonal antibody (B02P)MaxPab

  • Catalog # : H00006819-B02P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human SULT1C2 protein.
  • Immunogen:
  • SULT1C2 (NP_001047.1, 1 a.a. ~ 296 a.a) full-length human protein.
  • Sequence:
  • MALTSDLGKQIKLKEVEGTLLQPATVDNWSQIQSFEAKPDDLLICTYPKAGTTWIQEIVDMIEQNGDVEKCQRAIIQHRHPFIEWARPPQPSGVEKAKAMPSPRILKTHLSTQLLPPSFWENNCKFLYVARNAKDCMVSYYHFQRMNHMLPDPGTWEEYFETFINGKVVWGSWFDHVKGWWEMKDRHQILFLFYEDIKRDPKHEIRKVMQFMGKKVDETVLDKIVQETSFEKMKENPMTNRSTVSKSILDQSISSFMRKGTVGDWKNHFTVAQNERFDEIYRRKMEGTSINFCMEL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • SULT1C1 MaxPab polyclonal antibody. Western Blot analysis of SULT1C1 expression in human stomach.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of SULT1C2 expression in transfected 293T cell line (H00006819-T02) by SULT1C2 MaxPab polyclonal antibody.

    Lane 1: SULT1C1 transfected lysate(32.56 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 6819
  • Gene Name:
  • SULT1C2
  • Gene Alias:
  • ST1C1,ST1C2,SULT1C1,humSULTC2
  • Gene Description:
  • sulfotransferase family, cytosolic, 1C, member 2
  • Gene Summary:
  • Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a protein that belongs to the SULT1 subfamily, responsible for transferring a sulfo moiety from PAPS to phenol-containing compounds. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq
  • Other Designations:
  • sulfotransferase 1C1,sulfotransferase family, cytosolic, 1C, member 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook