SULT1C1 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of SULT1C2 expression in transfected 293T cell line (H00006819-T01) by SULT1C2 MaxPab polyclonal antibody.
Lane 1: SULT1C1 transfected lysate(32.67 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human SULT1C1 protein.
Immunogen
SULT1C1 (AAH05353, 1 a.a. ~ 296 a.a) full-length human protein.
Sequence
MALTSDLGKQIKLKEVEGTLLQPATVDNWSQIQSFEAKPDDLLICTYPKAGTTWIQEIVDMIEQNGDVEKCQRAIIQHRHPFIEWARPPQPSGVEKAKAMPSPRILKTHLSTQLLPPSFWENNCKFLYVARNAKDCMVSYYHFQRMNHMLPDPGTWEEYFETFINGKVVWGSWFDHVKGWWEMKDRHQILFLFYEDIKRDPKHEIRKVMQFMGKKVDETVLDKIVQETSFEKMKENPMTNRSTVSKSILDQSISSFMRKGTVGDWKNHFTVAQNERFDEIYRRKMEGTSINFCMEL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (83)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of SULT1C2 expression in transfected 293T cell line (H00006819-T01) by SULT1C2 MaxPab polyclonal antibody.
Lane 1: SULT1C1 transfected lysate(32.67 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — SULT1C2
Entrez GeneID
6819GeneBank Accession#
BC005353Protein Accession#
AAH05353Gene Name
SULT1C2
Gene Alias
ST1C1, ST1C2, SULT1C1, humSULTC2
Gene Description
sulfotransferase family, cytosolic, 1C, member 2
Omim ID
602385Gene Ontology
HyperlinkGene Summary
Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a protein that belongs to the SULT1 subfamily, responsible for transferring a sulfo moiety from PAPS to phenol-containing compounds. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq
Other Designations
sulfotransferase 1C1|sulfotransferase family, cytosolic, 1C, member 1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com