STAT5B monoclonal antibody (M03), clone 2D1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
STAT5B monoclonal antibody (M03), clone 2D1 Western Blot analysis of STAT5B expression in HeLa ( Cat # L013V1 ).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to STAT5B on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 1.5 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged STAT5B is approximately 0.3ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to STAT5B on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (37.84 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant STAT5B.
Immunogen
STAT5B (NP_036580, 678 a.a. ~ 787 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
VYSKYYTPVPCESATAKAVDGYVKPQIKQVVPEFVNASADAGGGSATYMDQAPSPAVCPQAHYNMYPQNPDSVLDTDGDFDLEDTMDVARRVEELLGRPMDSQWIPHAQS
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
STAT5B monoclonal antibody (M03), clone 2D1 Western Blot analysis of STAT5B expression in HeLa ( Cat # L013V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to STAT5B on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 1.5 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged STAT5B is approximately 0.3ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to STAT5B on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — STAT5B
Entrez GeneID
6777GeneBank Accession#
NM_012448Protein Accession#
NP_036580Gene Name
STAT5B
Gene Alias
STAT5
Gene Description
signal transducer and activator of transcription 5B
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein mediates the signal transduction triggered by various cell ligands, such as IL2, IL4, CSF1, and different growth hormones. It has been shown to be involved in diverse biological processes, such as TCR signaling, apoptosis, adult mammary gland development, and sexual dimorphism of liver gene expression. This gene was found to fuse to retinoic acid receptor-alpha (RARA) gene in a small subset of acute promyelocytic leukemias (APLL). The dysregulation of the signaling pathways mediated by this protein may be the cause of the APLL. [provided by RefSeq
Other Designations
transcription factor STAT5B
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com