Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SOX12 (Human) Recombinant Protein (Q01)

  • Catalog # : H00006666-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SOX12 partial ORF ( NP_008874, 252 a.a. - 313 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • LGFLSRLPPGPAGLDCSALDRDPDLQPPSGTSHFEFPDYCTPEVTEMIAGDWRPSSIADLVF
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 32.56
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00006666-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 6666
  • Gene Name:
  • SOX12
  • Gene Alias:
  • SOX22
  • Gene Description:
  • SRY (sex determining region Y)-box 12
  • Gene Summary:
  • Members of the SOX family of transcription factors are characterized by the presence of a DNA-binding high mobility group (HMG) domain, homologous to the HMG box of sex-determining region Y (SRY). Forming a subgroup of the HMG domain superfamily, SOX proteins have been implicated in cell fate decisions in a diverse range of developmental processes. SOX transcription factors have diverse tissue-specific expression patterns during early development and have been proposed to act as target-specific transcription factors and/or as chromatin structure regulatory elements. The protein encoded by this gene was identified as a SOX family member based on conserved domains and its expression in various tissues suggests a role in both differentiation and maintenance of several cell types. [provided by RefSeq
  • Other Designations:
  • SOX-22 protein,SRY (sex determining region Y)-box 22,SRY-related HMG-box gene 22
  • RSS
  • YouTube
  • Linkedin
  • Facebook