SOX12 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human SOX12 partial ORF ( NP_008874, 252 a.a. - 313 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
LGFLSRLPPGPAGLDCSALDRDPDLQPPSGTSHFEFPDYCTPEVTEMIAGDWRPSSIADLVF
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
32.56
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — SOX12
Entrez GeneID
6666GeneBank Accession#
NM_006943Protein Accession#
NP_008874Gene Name
SOX12
Gene Alias
SOX22
Gene Description
SRY (sex determining region Y)-box 12
Omim ID
601947Gene Ontology
HyperlinkGene Summary
Members of the SOX family of transcription factors are characterized by the presence of a DNA-binding high mobility group (HMG) domain, homologous to the HMG box of sex-determining region Y (SRY). Forming a subgroup of the HMG domain superfamily, SOX proteins have been implicated in cell fate decisions in a diverse range of developmental processes. SOX transcription factors have diverse tissue-specific expression patterns during early development and have been proposed to act as target-specific transcription factors and/or as chromatin structure regulatory elements. The protein encoded by this gene was identified as a SOX family member based on conserved domains and its expression in various tissues suggests a role in both differentiation and maintenance of several cell types. [provided by RefSeq
Other Designations
SOX-22 protein|SRY (sex determining region Y)-box 22|SRY-related HMG-box gene 22
-
Interactome
-
Publication Reference
-
SOX12 contributes to the activation of the JAK2/STAT3 pathway and malignant transformation of esophageal squamous cell carcinoma.
Chunguang Li, Maoling Zhu, Ji Zhu, Qijue Lu, Bowen Shi, Bin Sun, Hezhong Chen.
Oncology Reports 2021 Jan; 45(1):129.
Application:Func, Human, Eca109, TE1 cells.
-
SOX12 contributes to the activation of the JAK2/STAT3 pathway and malignant transformation of esophageal squamous cell carcinoma.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com