Product Browser

Last updated: 2017/4/23
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SOS1 polyclonal antibody (A01)

  • Catalog # : H00006654-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant SOS1.
  • Immunogen:
  • SOS1 (NP_005624, 313 a.a. ~ 420 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • SQLSKPGAALYLQSIGEGFKEAVQYVLPRLLLAPVYHCLHYFELLKQLEEKSEDQEDKECLKQAITALLNVQSGMEKICSKSLAKRRLSESACRFYSQQMKGKQLAIK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00006654-A01
    Western Blot detection against Immunogen (37.99 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 6654
  • Gene Name:
  • SOS1
  • Gene Alias:
  • GF1,GGF1,GINGF,HGF,NS4
  • Gene Description:
  • son of sevenless homolog 1 (Drosophila)
  • Gene Summary:
  • This gene encodes a protein that is a guanine nucleotide exchange factor for RAS proteins, membrane proteins that bind guanine nucleotides and participate in signal transduction pathways. GTP binding activates and GTP hydrolysis inactivates RAS proteins. The product of this gene may regulate RAS proteins by facilitating the exchange of GTP for GDP. Mutations in this gene are associated with gingival fibromatosis 1 and Noonan syndrome type 4. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000128306,gingival fibromatosis, hereditary, 1,guanine nucleotide exchange factor,son of sevenless homolog 1
  • Interactome
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook