Product Browser

Last updated: 2017/8/20
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SLIT3 polyclonal antibody (A01)

  • Catalog # : H00006586-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant SLIT3.
  • Immunogen:
  • SLIT3 (NP_003053, 1371 a.a. ~ 1470 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • PCLGHRCHHGKCVATGTSYMCKCAEGYGGDLCDNKNDSANACSAFKCHHGQCHISDQGEPYCLCQPGFSGEHCQQENPCLGQVVREVIRRQKGYASCATA
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00006586-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 6586
  • Gene Name:
  • SLIT3
  • Gene Alias:
  • FLJ10764,MEGF5,SLIL2,SLIT1,Slit-3,slit2
  • Gene Description:
  • slit homolog 3 (Drosophila)
  • Other Designations:
  • slit homolog 3
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook