Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SKP1 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00006500-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human SKP1 protein.
  • Immunogen:
  • SKP1 (NP_008861.2, 1 a.a. ~ 160 a.a) full-length human protein.
  • Sequence:
  • MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVGSTQFCL
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of SKP1 expression in transfected 293T cell line (H00006500-T02) by SKP1 MaxPab polyclonal antibody.

    Lane 1: SKP1 transfected lysate(18.10 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • In situ Proximity Ligation Assay (Cell)
  • <em>In situ</em> Proximity Ligation Assay (Cell)
  • Proximity Ligation Analysis of protein-protein interactions between SKP1 and CACYBP. HeLa cells were stained with anti-SKP1 rabbit purified polyclonal 1:1200 and anti-CACYBP mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • In situ Proximity Ligation Assay (Cell)
  • <em>In situ</em> Proximity Ligation Assay (Cell)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 6500
  • Gene Name:
  • SKP1
  • Gene Alias:
  • EMC19,MGC34403,OCP-II,OCP2,SKP1A,TCEB1L,p19A
  • Gene Description:
  • S-phase kinase-associated protein 1
  • Gene Summary:
  • This gene encodes a component of SCF complexes, which are composed of this protein, cullin 1, a ring-box protein, and one member of the F-box family of proteins. This protein binds directly to the F-box motif found in F-box proteins. SCF complexes are involved in the regulated ubiquitination of specific protein substrates, which targets them for degradation by the proteosome. Specific F-box proteins recognize different target protein(s), and many specific SCF substrates have been identified including regulators of cell cycle progression and development. Studies have also characterized the protein as an RNA polymerase II elongation factor. Alternative splicing of this gene results in two transcript variants. A related pseudogene has been identified on chromosome 7. [provided by RefSeq
  • Other Designations:
  • RNA polymerase II elongation factor-like protein OCP2,cyclin A/CDK2-associated p19,organ of Corti protein 2,transcription elongation factor B (SIII), polypeptide 1-like
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook