Product Browser

Last updated: 2017/11/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CCL5 (Human) Recombinant Protein (P01)

  • Catalog # : H00006352-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CCL5 full-length ORF ( AAH08600, 1 a.a. - 91 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.75
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00006352-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 6352
  • Gene Name:
  • CCL5
  • Gene Alias:
  • D17S136E,MGC17164,RANTES,SCYA5,SISd,TCP228
  • Gene Description:
  • chemokine (C-C motif) ligand 5
  • Gene Summary:
  • This gene is one of several CC cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene functions as a chemoattractant for blood monocytes, memory T helper cells and eosinophils. It causes the release of histamine from basophils and activates eosinophils. This cytokine is one of the major HIV-suppressive factors produced by CD8+ cells. It functions as one of the natural ligands for the chemokine receptor CCR5 and it suppresses in vitro replication of the R5 strains of HIV-1, which use CCR5 as a coreceptor. [provided by RefSeq
  • Other Designations:
  • SIS-delta,T-cell specific RANTES protein,T-cell specific protein p288,beta-chemokine RANTES,regulated upon activation, normally T-expressed, and presumably secreted,small inducible cytokine A5,small inducible cytokine A5 (RANTES),small inducible cytokine
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook