S100P purified MaxPab mouse polyclonal antibody (B03P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of S100P expression in transfected 293T cell line (H00006286-T03) by S100P MaxPab polyclonal antibody.
Lane 1: S100P transfected lysate(10.56 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to S100P on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human S100P protein.
Immunogen
S100P (AAH06819, 1 a.a. ~ 95 a.a) full-length human protein.
Sequence
MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of S100P expression in transfected 293T cell line (H00006286-T03) by S100P MaxPab polyclonal antibody.
Lane 1: S100P transfected lysate(10.56 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to S100P on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — S100P
Entrez GeneID
6286GeneBank Accession#
BC006819Protein Accession#
AAH06819Gene Name
S100P
Gene Alias
MIG9
Gene Description
S100 calcium binding protein P
Omim ID
600614Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21; however, this gene is located at 4p16. This protein, in addition to binding Ca2+, also binds Zn2+ and Mg2+. This protein may play a role in the etiology of prostate cancer. [provided by RefSeq
Other Designations
OTTHUMP00000115574|S100 calcium-binding protein P|migration-inducing gene 9
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com