S100A13 monoclonal antibody (M01), clone 3A7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
S100A13 monoclonal antibody (M01), clone 3A7 Western Blot analysis of S100A13 expression in MCF-7 ( Cat # L046V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of S100A13 expression in transfected 293T cell line by S100A13 monoclonal antibody (M01), clone 3A7.
Lane 1: S100A13 transfected lysate(11.5 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged S100A13 is approximately 0.1ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to S100A13 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.52 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant S100A13.
Immunogen
S100A13 (NP_005970, 1 a.a. ~ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.52 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
S100A13 monoclonal antibody (M01), clone 3A7 Western Blot analysis of S100A13 expression in MCF-7 ( Cat # L046V1 ).Western Blot (Transfected lysate)
Western Blot analysis of S100A13 expression in transfected 293T cell line by S100A13 monoclonal antibody (M01), clone 3A7.
Lane 1: S100A13 transfected lysate(11.5 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged S100A13 is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to S100A13 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — S100A13
Entrez GeneID
6284GeneBank Accession#
NM_005979Protein Accession#
NP_005970Gene Name
S100A13
Gene Alias
-
Gene Description
S100 calcium binding protein A13
Omim ID
601989Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein is widely expressed in various types of tissues with a high expression level in thyroid gland. In smooth muscle cells, this protein co-expresses with other family members in the nucleus and in stress fibers, suggesting diverse functions in signal transduction. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000034802|S100 calcium-binding protein A13
-
Interactome
-
Publication Reference
-
Annexin A2 Flop-Out Mediates the Non-Vesicular Release of DAMPs/Alarmins from C6 Glioma Cells Induced by Serum-Free Conditions.
Hayato Matsunaga, Sebok Kumar Halder, Hiroshi Ueda.
Cells 2021 Mar; 10(3):567.
Application：PLA, ELISA(protein binding assay), Rat, C6 glioma cells.
-
Involvement of SNARE Protein Interaction for Non-classical Release of DAMPs/Alarmins Proteins, Prothymosin Alpha and S100A13.
Hayato Matsunaga, Sebok Kumar Halder, Hiroshi Ueda.
Cellular and Molecular Neurobiology 2021 Nov; 41(8):1817.
Application：ICC, WB, Human, C6 cell.
-
Annexin A2 Flop-Out Mediates the Non-Vesicular Release of DAMPs/Alarmins from C6 Glioma Cells Induced by Serum-Free Conditions.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com