S100A13 MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human S100A13 protein.
Immunogen
S100A13 (NP_001019381.1, 1 a.a. ~ 98 a.a) full-length human protein.
Sequence
MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
S100A13 MaxPab polyclonal antibody. Western Blot analysis of S100A13 expression in HepG2.Western Blot (Transfected lysate)
Western Blot analysis of S100A13 expression in transfected 293T cell line (H00006284-T01) by S100A13 MaxPab polyclonal antibody.
Lane 1: S100A13 transfected lysate(10.78 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to S100A13 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — S100A13
Entrez GeneID
6284GeneBank Accession#
NM_001024210.1Protein Accession#
NP_001019381.1Gene Name
S100A13
Gene Alias
-
Gene Description
S100 calcium binding protein A13
Omim ID
601989Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein is widely expressed in various types of tissues with a high expression level in thyroid gland. In smooth muscle cells, this protein co-expresses with other family members in the nucleus and in stress fibers, suggesting diverse functions in signal transduction. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000034802|S100 calcium-binding protein A13
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com