S100A2 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human S100A2 protein.
Immunogen
S100A2 (AAH02829, 1 a.a. ~ 97 a.a) full-length human protein.
Sequence
MCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDRP
Host
Rabbit
Reactivity
Human, Mouse
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
S100A2 MaxPab rabbit polyclonal antibody. Western Blot analysis of S100A2 expression in human pancreas.Western Blot (Tissue lysate)
S100A2 MaxPab rabbit polyclonal antibody. Western Blot analysis of S100A2 expression in mouse liver.Western Blot (Transfected lysate)
Western Blot analysis of S100A2 expression in transfected 293T cell line (H00006273-T01) by S100A2 MaxPab polyclonal antibody.
Lane 1: S100A2 transfected lysate(10.78 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — S100A2
Entrez GeneID
6273GeneBank Accession#
BC002829Protein Accession#
AAH02829Gene Name
S100A2
Gene Alias
CAN19, MGC111539, S100L
Gene Description
S100 calcium binding protein A2
Omim ID
176993Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may have a tumor suppressor function. Chromosomal rearrangements and altered expression of this gene have been implicated in breast cancer. [provided by RefSeq
Other Designations
OTTHUMP00000032968|OTTHUMP00000032969|S100 calcium-binding protein A2
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com