RPS3A polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant RPS3A.
Immunogen
RPS3A (NP_000997, 164 a.a. ~ 263 a.a) partial recombinant protein with GST tag.
Sequence
IRKKMMEIMTREVQTNDLKEVVNKLIPDSIGKDIEKACQSIYPLHDVFVRKVKMLKKPKFELGKLMELHGEGSSSGKATGDETGAKVERADGYEPPVQES
Host
Mouse
Reactivity
Human, Mouse, Rat
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.11 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RPS3A polyclonal antibody (A01), Lot # ONW0060316QCS1. Western Blot analysis of RPS3A expression in Raw 264.7.Western Blot (Cell lysate)
RPS3A polyclonal antibody (A01), Lot # ONW0060316QCS1. Western Blot analysis of RPS3A expression in PC-12.Western Blot (Cell lysate)
RPS3A polyclonal antibody (A01), Lot # ONW0060316QCS1. Western Blot analysis of RPS3A expression in NIH/3T3.Western Blot (Cell lysate)
RPS3A polyclonal antibody (A01), Lot # ONW0060316QCS1 Western Blot analysis of RPS3A expression in HeLa ( Cat # L013V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — RPS3A
Entrez GeneID
6189GeneBank Accession#
NM_001006Protein Accession#
NP_000997Gene Name
RPS3A
Gene Alias
FTE1, MFTL, MGC23240
Gene Description
ribosomal protein S3A
Omim ID
180478Gene Ontology
HyperlinkGene Summary
Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S3AE family of ribosomal proteins. It is located in the cytoplasm. Disruption of the gene encoding rat ribosomal protein S3a, also named v-fos transformation effector protein, in v-fos-transformed rat cells results in reversion of the transformed phenotype. Transcript variants utilizing alternative transcription start sites have been described. This gene is co-transcribed with the U73A and U73B small nucleolar RNA genes, which are located in its fourth and third introns, respectively. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq
Other Designations
40S ribosomal protein S3a|ribosomal protein S3a|v-fos transformation effector protein 1
-
Interactome
-
Pathway
-
Publication Reference
-
Monoclonal antibodies against human translation termination factor eRF3 and their utilisation for subcellular localisation of eRF3.
Delage M, Dutertre S, Le Guevel R, Frolova L, Berkova N.
Journal of Biochemistry 2011 Jul; 150(1):49.
Application:IF, Human, A549, HeLa cells.
-
Monoclonal antibodies against human translation termination factor eRF3 and their utilisation for subcellular localisation of eRF3.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com