RPL29 purified MaxPab mouse polyclonal antibody (B02P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse polyclonal antibody raised against a full-length human RPL29 protein.
Immunogen
RPL29 (NP_000983.1, 1 a.a. ~ 157 a.a) full-length human protein.
Sequence
MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGLKKMQANNAKAMSARAEAIKALVKPKEVKPKIPKGVSRKLDRLAYIAHPKLGKRARARIAKGLRLCRPKAKAKAKDQTKAQAAAPASVPAQAPKRTQAPTKASE
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
RPL29 MaxPab polyclonal antibody. Western Blot analysis of RPL29 expression in human pancreas.Western Blot (Cell lysate)
RPL29 MaxPab polyclonal antibody. Western Blot analysis of RPL29 expression in HeLa.Western Blot (Transfected lysate)
Western Blot analysis of RPL29 expression in transfected 293T cell line (H00006159-T02) by RPL29 MaxPab polyclonal antibody.
Lane 1: RPL29 transfected lysate(17.49 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of purified MaxPab antibody to RPL29 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]Immunofluorescence
Immunofluorescence of purified MaxPab antibody to RPL29 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — RPL29
Entrez GeneID
6159GeneBank Accession#
NM_000992Protein Accession#
NP_000983.1Gene Name
RPL29
Gene Alias
HIP, HUMRPL29, MGC88589
Gene Description
ribosomal protein L29
Omim ID
601832Gene Ontology
HyperlinkGene Summary
Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a cytoplasmic ribosomal protein that is a component of the 60S subunit. The protein belongs to the L29E family of ribosomal proteins. The protein is also a peripheral membrane protein expressed on the cell surface that directly binds heparin. Although this gene was previously reported to map to 3q29-qter, it is believed that it is located at 3p21.3-p21.2. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq
Other Designations
60S ribosomal protein L29|HP/HS-interacting protein|OTTHUMP00000017090|cell surface heparin-binding protein HIP|heparin/heparan sulfate-binding protein|heparin/heparan sulfate-interacting protein
-
Interactomes
-
Pathways
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com