Product Browser

Last updated: 2017/3/26
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RPL3L polyclonal antibody (A01)

  • Catalog # : H00006123-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant RPL3L.
  • Immunogen:
  • RPL3L (NP_005052, 280 a.a. ~ 360 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • LNKKIFRIGRGPHMEDGKLVKNNASTSYDVTAKSITPLGGFPHYGEVNNDFVMLKGCIAGTKKRVITLRKSLLVHHSRQAV
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00006123-A01
    Western Blot detection against Immunogen (35.02 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 6123
  • Gene Name:
  • RPL3L
  • Gene Alias:
  • -
  • Gene Description:
  • ribosomal protein L3-like
  • Gene Summary:
  • This gene encodes a protein that shares sequence similarity with ribosomal protein L3. The protein belongs to the L3P family of ribosomal proteins. Unlike the ubiquitous expression of ribosomal protein genes, this gene has a tissue-specific pattern of expression, with the highest levels of expression in skeletal muscle and heart. It is not currently known whether the encoded protein is a functional ribosomal protein or whether it has evolved a function that is independent of the ribosome. [provided by RefSeq
  • Other Designations:
  • 60S ribosomal protein L3-like
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook