Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PTS purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00005805-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human PTS protein.
  • Immunogen:
  • PTS (NP_000308.1, 1 a.a. ~ 145 a.a) full-length human protein.
  • Sequence:
  • MSTEGGGRRCQAQVSRRISFSASHRLYSKFLSDEENLKLFGKCNNPNGHGHNYKVVVTVHGEIDPATGMVMNLADLKKYMEEAIMQPLDHKNLDMDVPYFADVVSTTENVAVYIWDNLQKVLPVGVLYKVKVYETDNNIVVYKGE
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of PTS expression in transfected 293T cell line (H00005805-T01) by PTS MaxPab polyclonal antibody.

    Lane 1: PTS transfected lysate(15.95 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 5805
  • Gene Name:
  • PTS
  • Gene Alias:
  • FLJ97081,PTPS
  • Gene Description:
  • 6-pyruvoyltetrahydropterin synthase
  • Gene Summary:
  • The enzyme encoded by this gene catalyzes the elimination of inorganic triphosphate from dihydroneopterin triphosphate, which is the second and irreversible step in the biosynthesis of tetrahydrobiopterin from GTP. Tetrahydrobiopterin, also known as BH(4), is an essential cofactor and regulator of various enzyme activities, including enzymes involved in serotonin biosynthesis and NO synthase activity. Mutations in this gene result in hyperphenylalaninemia. [provided by RefSeq
  • Other Designations:
  • 6-pyruvoyl tetrahydrobiopterin synthase,6-pyruvoyl-tetrahydropterin synthase,PTP synthase
  • RSS
  • YouTube
  • Linkedin
  • Facebook