MAP2K5 monoclonal antibody (M03), clone 1E5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between MAP3K3 and MAP2K5. HeLa cells were stained with anti-MAP3K3 rabbit purified polyclonal 1:1200 and anti-MAP2K5 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Immunofluorescence
Immunofluorescence of monoclonal antibody to MAP2K5 on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (38.83 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant MAP2K5.
Immunogen
MAP2K5 (AAH08838, 1 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MLWLALGPFPAMENQVLVIRIKIPNSGAVDWTVHSGPQLLFRDVLDVIGQVLPEATTTAFEYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIFPRACKPPGERNIHGL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (38.83 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between MAP3K3 and MAP2K5. HeLa cells were stained with anti-MAP3K3 rabbit purified polyclonal 1:1200 and anti-MAP2K5 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).Immunofluorescence
Immunofluorescence of monoclonal antibody to MAP2K5 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — MAP2K5
Entrez GeneID
5607GeneBank Accession#
BC008838Protein Accession#
AAH08838Gene Name
MAP2K5
Gene Alias
HsT17454, MAPKK5, MEK5, PRKMK5
Gene Description
mitogen-activated protein kinase kinase 5
Omim ID
602520Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase specifically interacts with and activates MAPK7/ERK5. This kinase itself can be phosphorylated and activated by MAP3K3/MEKK3, as well as by atypical protein kinase C isoforms (aPKCs). The signal cascade mediated by this kinase is involved in growth factor stimulated cell proliferation and muscle cell differentiation. Four alternatively spliced transcript variants of this gene encoding distinct isoforms have been described. [provided by RefSeq
Other Designations
MAP kinase kinase MEK5b|MAPK/ERK kinase 5|dual specificity mitogen-activated protein kinase kinase 5
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com