Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MAPK13 monoclonal antibody (M06A), clone 3D8

  • Catalog # : H00005603-M06A
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant MAPK13.
  • Immunogen:
  • MAPK13 (AAH00433, 251 a.a. ~ 365 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • NDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDRRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2b Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00005603-M06A
    Western Blot detection against Immunogen (38.28 KDa) .
  • Storage Buffer:
  • In ascites fluid
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of MAPK13 expression in transfected 293T cell line by MAPK13 monoclonal antibody (M06A), clone 3D8.

    Lane 1: MAPK13 transfected lysate(42.1 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of MAPK13 transfected lysate using anti-MAPK13 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with MAPK13 MaxPab rabbit polyclonal antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5603
  • Gene Name:
  • MAPK13
  • Gene Alias:
  • MGC99536,PRKM13,SAPK4,p38delta
  • Gene Description:
  • mitogen-activated protein kinase 13
  • Gene Summary:
  • The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is closely related to p38 MAP kinase, both of which can be activated by proinflammatory cytokines and cellular stress. MAP kinase kinases 3, and 6 can phosphorylate and activate this kinase. Transcription factor ATF2, and microtubule dynamics regulator stathmin have been shown to be the substrates of this kinase. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000016282,mitogen-activated protein kinase p38 delta,stress-activated protein kinase 4
  • RSS
  • YouTube
  • Linkedin
  • Facebook