Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MAPK13 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00005603-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human MAPK13 protein.
  • Immunogen:
  • MAPK13 (NP_002745.1, 1 a.a. ~ 365 a.a) full-length human protein.
  • Sequence:
  • MSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPFQSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFYDFYLVMPFMQTDLQKIMGMEFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMTGYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of MAPK13 expression in transfected 293T cell line (H00005603-T02) by MAPK13 MaxPab polyclonal antibody.

    Lane 1: MAPK13 transfected lysate(42.10 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • In situ Proximity Ligation Assay (Cell)
  • <em>In situ</em> Proximity Ligation Assay (Cell)
  • Proximity Ligation Analysis of protein-protein interactions between MAPK13 and MAPKAPK3. HeLa cells were stained with anti-MAPK13 rabbit purified polyclonal 1:1200 and anti-MAPKAPK3 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • In situ Proximity Ligation Assay (Cell)
  • <em>In situ</em> Proximity Ligation Assay (Cell)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 5603
  • Gene Name:
  • MAPK13
  • Gene Alias:
  • MGC99536,PRKM13,SAPK4,p38delta
  • Gene Description:
  • mitogen-activated protein kinase 13
  • Gene Summary:
  • The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is closely related to p38 MAP kinase, both of which can be activated by proinflammatory cytokines and cellular stress. MAP kinase kinases 3, and 6 can phosphorylate and activate this kinase. Transcription factor ATF2, and microtubule dynamics regulator stathmin have been shown to be the substrates of this kinase. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000016282,mitogen-activated protein kinase p38 delta,stress-activated protein kinase 4
  • RSS
  • YouTube
  • Linkedin
  • Facebook