PRKAR2A monoclonal antibody (M01), clone 6A9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
PRKAR2A monoclonal antibody (M01), clone 6A9 Western Blot analysis of PRKAR2A expression in HeLa ( Cat # L013V1 ).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to PRKAR2A on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PRKAR2A is approximately 0.03ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to PRKAR2A on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (37.18 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PRKAR2A.
Immunogen
PRKAR2A (AAH02763, 1 a.a. ~ 105 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARAPASVLPAATPRQSLGHPPPEPGPDRVADAKGDSESEEDEDLEVPVPSRFNRRVSVCAETY
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (66); Rat (64)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.18 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PRKAR2A monoclonal antibody (M01), clone 6A9 Western Blot analysis of PRKAR2A expression in HeLa ( Cat # L013V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to PRKAR2A on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PRKAR2A is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to PRKAR2A on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — PRKAR2A
Entrez GeneID
5576GeneBank Accession#
BC002763Protein Accession#
AAH02763Gene Name
PRKAR2A
Gene Alias
MGC3606, PKR2, PRKAR2
Gene Description
protein kinase, cAMP-dependent, regulatory, type II, alpha
Omim ID
176910Gene Ontology
HyperlinkGene Summary
cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins. The inactive kinase holoenzyme is a tetramer composed of two regulatory and two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans. The protein encoded by this gene is one of the regulatory subunits. This subunit can be phosphorylated by the activated catalytic subunit. It may interact with various A-kinase anchoring proteins and determine the subcellular localization of cAMP-dependent protein kinase. This subunit has been shown to regulate protein transport from endosomes to the Golgi apparatus and further to the endoplasmic reticulum (ER). [provided by RefSeq
Other Designations
cAMP-dependent protein kinase regulatory subunit RII alpha|cAMP-dependent protein kinase, regulatory subunit alpha 2|protein kinase A, RII-alpha subunit
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com