PPP2R5A (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human PPP2R5A partial ORF ( NP_006234, 352 a.a. - 438 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
LFKQISKCVSSSHFQVAERALYFWNNEYILSLIEENIDKILPIMFASLYKISKEHWNPTIVALVYNVLKTLMEMNGKLFDDLTSSYK
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
35.31
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — PPP2R5A
Entrez GeneID
5525GeneBank Accession#
NM_006243Protein Accession#
NP_006234Gene Name
PPP2R5A
Gene Alias
B56A, MGC131915, PR61A
Gene Description
protein phosphatase 2, regulatory subunit B', alpha isoform
Omim ID
601643Gene Ontology
HyperlinkGene Summary
The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes an alpha isoform of the regulatory subunit B56 subfamily. [provided by RefSeq
Other Designations
OTTHUMP00000034891|PP2A, B subunit, B' alpha isoform|PP2A, B subunit, B56 alpha isoform|PP2A, B subunit, PR61 alpha isoform|PP2A, B subunit, R5 alpha isoform|protein phosphatase 2, regulatory subunit B (B56), alpha isoform|serine/threonine protein phospha
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com