PPA1 monoclonal antibody (M01), clone 3B2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PPA1.
Immunogen
PPA1 (NP_066952, 10 a.a. ~ 111 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
AAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAKMEIATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPGHNDKHT
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (97); Rat (95)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.96 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PPA1 monoclonal antibody (M01), clone 3B2 Western Blot analysis of PPA1 expression in A-431 ( Cat # L015V1 ).Western Blot (Cell lysate)
PPA1 monoclonal antibody (M01), clone 3B2. Western Blot analysis of PPA1 expression in PC-12 ( Cat # L012V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PPA1 is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — PPA1
Entrez GeneID
5464GeneBank Accession#
NM_021129Protein Accession#
NP_066952Gene Name
PPA1
Gene Alias
IOPPP, MGC111556, PP, PP1, SID6-8061
Gene Description
pyrophosphatase (inorganic) 1
Omim ID
179030Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the inorganic pyrophosphatase (PPase) family. PPases catalyze the hydrolysis of pyrophosphate to inorganic phosphate, which is important for the phosphate metabolism of cells. Studies of a similar protein in bovine suggested a cytoplasmic localization of this enzyme. [provided by RefSeq
Other Designations
OTTHUMP00000019741|PPase|cytosolic inorganic pyrophosphatase|diphosphate phosphohydrolase|inorganic diphosphatase|inorganic pyrophosphatase 1|pyrophosphatase 1|pyrophosphate phospho-hydrolase
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com