Product Browser

Last updated: 2020/2/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PLAUR (Human) Recombinant Protein HuPro Protein

  • Catalog # : H00005329-H02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Purified PLAUR (NP_002650.1 23 a.a. - 350 a.a.) human recombinant protein with His-Flag-StrepII tag at C-terminus expressed in human cells.
  • Transfected Cell Line:
  • Human HEK293H cells
  • Sequence:
  • LRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQYRSG
  • Host:
  • Human
  • Theoretical MW (kDa):
  • 34.21
  • Form:
  • Liquid
  • Preparation Method:
  • Transfection of pSuper-PLAUR plasmid into HEK293H cell, and the expressed protein was purified by Strep-Tactin affinity column.
  • Purification:
  • Strep-Tactin affinity columns
  • Concentration:
  • ≥ 10 ug/ml
  • Activity:
  • Not Tested
  • Quality Control Testing:
  • Western Blot
    Western Blot
    QC Testing of H00005329-H02
  • Storage Buffer:
  • 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Interspecies Antigen Sequence:
  • Mouse (36%); Rat (32%)
  • Gene Information
  • Entrez GeneID:
  • 5329
  • Gene Name:
  • PLAUR
  • Gene Alias:
  • CD87,UPAR,URKR
  • Gene Description:
  • plasminogen activator, urokinase receptor
  • Gene Summary:
  • This gene encodes the receptor for urokinase plasminogen activator and, given its role in localizing and promoting plasmin formation, likely influences many normal and pathological processes related to cell-surface plasminogen activation and localized degradation of the extracellular matrix. It binds both the proprotein and mature forms of urokinase plasminogen activator and permits the activation of the receptor-bound pro-enzyme by plasmin. The protein lacks transmembrane or cytoplasmic domains and may be anchored to the plasma membrane by a glycosyl-phosphatidylinositol (GPI) moiety following cleavage of the nascent polypeptide near its carboxy-terminus. However, a soluble protein is also produced in some cell types. Alternative splicing results in multiple transcript variants encoding different isoforms. The proprotein experiences several post-translational cleavage reactions that have not yet been fully defined. [provided by RefSeq
  • Other Designations:
  • monocyte activation antigen Mo3,u-plasminogen activator receptor form 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook