PKD2 monoclonal antibody (M01), clone 4C8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
PKD2 monoclonal antibody (M01), clone 4C8. Western Blot analysis of PKD2 expression in human liver.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PKD2 is approximately 0.3ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to PKD2 on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.74 KDa) .
-
Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant PKD2.
Immunogen
PKD2 (NP_000288, 261 a.a. ~ 360 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PVSKTEKTNFKTLSSMEDFWKFTEGSLLDGLYWKMQPSNQTEADNRSFIFYENLLLGVPRIRQLRVRNGSCSIPQDLRDEIKECYDVYSVSSEDRAPFGP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (94); Rat (94)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
PKD2 monoclonal antibody (M01), clone 4C8. Western Blot analysis of PKD2 expression in human liver.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PKD2 is approximately 0.3ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to PKD2 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — PKD2
Entrez GeneID
5311GeneBank Accession#
NM_000297Protein Accession#
NP_000288Gene Name
PKD2
Gene Alias
APKD2, MGC138466, MGC138468, PC2, PKD4
Gene Description
polycystic kidney disease 2 (autosomal dominant)
Omim ID
173910Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the polycystin protein family. The encoded protein contains multiple transmembrane domains, and cytoplasmic N- and C-termini. The protein may be an integral membrane protein involved in cell-cell/matrix interactions. The encoded protein may function in renal tubular development, morphology, and function, and may modulate intracellular calcium homoeostasis and other signal transduction pathways. This protein interacts with polycystin 1 to produce cation-permeable currents. Mutations in this gene have been associated with autosomal dominant polycystic kidney disease. [provided by RefSeq
Other Designations
polycystin 2|polycystwin
-
Interactomes
-
Diseases
-
Publication Reference
-
Urinary extracellular vesicles signature for diagnosis of kidney disease.
Keiichi Takizawa, Koji Ueda, Masahiro Sekiguchi, Eiji Nakano, Tatsuya Nishimura, Yuko Kajiho, Shoichiro Kanda, Kenichiro Miura, Motoshi Hattori, Junya Hashimoto, Yuko Hamasaki, Masataka Hisano, Tae Omori, Takayuki Okamoto, Hirotsugu Kitayama, Naoya Fujita, Hiromi Kuramochi, Takanori Ichiki, Akira Oka, Yutaka Harita.
iScience 2022 Nov; 25(11):105416.
Application：ELISA, Human, Human urine.
-
Urinary extracellular vesicles signature for diagnosis of kidney disease.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com