PITX1 monoclonal antibody (M01), clone 5G4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
PITX1 monoclonal antibody (M01), clone 5G4 Western Blot analysis of PITX1 expression in Hela S3 NE ( Cat # L013V3 ).
Western Blot (Transfected lysate)
Western Blot analysis of PITX1 expression in transfected 293T cell line by PITX1 monoclonal antibody (M01), clone 5G4.
Lane 1: PITX1 transfected lysate(34.1 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of PITX1 transfected lysate using anti-PITX1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PITX1 MaxPab rabbit polyclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PITX1 is approximately 0.03ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of PITX1 over-expressed 293 cell line, cotransfected with PITX1 Validated Chimera RNAi ( Cat # H00005307-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PITX1 monoclonal antibody (M01), clone 5G4 (Cat # H00005307-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot detection against Immunogen (35.53 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PITX1.
Immunogen
PITX1 (NP_002644, 225 a.a. ~ 313 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MPSSMGPGAVPGMPNSGLNNINNLTGSSLNSAMSPGACPYGTPASPYSVYRDTCNSSLASLRLKSKQHSSFGYGGLQGPASGLNACQYN
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.53 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PITX1 monoclonal antibody (M01), clone 5G4 Western Blot analysis of PITX1 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Transfected lysate)
Western Blot analysis of PITX1 expression in transfected 293T cell line by PITX1 monoclonal antibody (M01), clone 5G4.
Lane 1: PITX1 transfected lysate(34.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of PITX1 transfected lysate using anti-PITX1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PITX1 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PITX1 is approximately 0.03ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of PITX1 over-expressed 293 cell line, cotransfected with PITX1 Validated Chimera RNAi ( Cat # H00005307-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PITX1 monoclonal antibody (M01), clone 5G4 (Cat # H00005307-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — PITX1
Entrez GeneID
5307GeneBank Accession#
NM_002653Protein Accession#
NP_002644Gene Name
PITX1
Gene Alias
BFT, POTX, PTX1
Gene Description
paired-like homeodomain 1
Omim ID
602149Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. Members of this family are involved in organ development and left-right asymmetry. This protein acts as a transcriptional regulator involved in basal and hormone-regulated activity of prolactin. [provided by RefSeq
Other Designations
hindlimb expressed homeobox protein backfoot|paired-like homeodomain transcription factor 1|pituitary homeo box 1|pituitary otx-related factor
-
Interactome
-
Disease
-
Publication Reference
-
Downregulated PITX1 Modulated by MiR-19a-3p Promotes Cell Malignancy and Predicts a Poor Prognosis of Gastric Cancer by Affecting Transcriptionally Activated PDCD5.
Qiao F, Gong P, Song Y, Shen X, Su X, Li Y, Wu H, Zhao Z, Fan H.
Cellular Physiology and Biochemistry 2018 May; 46(6):2215.
Application：ChIP, IHC-P, WB, WB-Tr, Human, AGS, BGC-823, MCG-803, SGC-7901, GES-1, MCG-PITX1 shRNA #1, MCG-PITX1 shRNA #10 , AGS-pcDNA3.1, AGS-pPITX1, MCG-803-pcDNA3.1, MCG-803-pPITX1 cells, Gastric cancers.
-
The c-Abl tyrosine kinase stabilizes Pitx1 in the apoptotic response to DNA damage.
Yamaguchi T, Miki Y, Yoshida K.
Apoptosis 2010 Aug; 15(8):927.
Application：WB-Ce, WB-Tr, Human, K-562, MCF-7, U-2 OS cells.
-
Transcriptional activation of p53 by Pitx1.
Liu DX, Lobie PE.
Cell Death and Differentiation 2007 Aug; 14(11):1893.
Application：WB-Tr, Human, MCF-7 cells.
-
Downregulated PITX1 Modulated by MiR-19a-3p Promotes Cell Malignancy and Predicts a Poor Prognosis of Gastric Cancer by Affecting Transcriptionally Activated PDCD5.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com