PITX1 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human PITX1 protein.
Immunogen
PITX1 (NP_002644.3, 1 a.a. ~ 314 a.a) full-length human protein.
Sequence
MDAFKGGMSLERLPEGLRPPPPPPHDMGPAFHLARPADPREPLENSASESSDTELPEKERGGEPKGPEDSGAGGTGCGGADDPAKKKKQRRQRTHFTSQQLQELEATFQRNRYPDMSMREEIAVWTNLTEPRVRVWFKNRRAKWRKRERNQQLDLCKGGYVPQFSGLVQPYEDVYAAGYSYNNWAAKSLAPAPLSTKSFTFFNSMSPLSSQSMFSAPSSISSMTMPSSMGPGAVPGMPNSGLNNINNLTGSSLNSAMSPGACPYGTPASPYSVYRDTCNSSLASLRLKSKQHSSFGYGALQGPASGLNACQYNS
Host
Rabbit
Reactivity
Human, Mouse
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
PITX1 MaxPab rabbit polyclonal antibody. Western Blot analysis of PITX1 expression in mouse brain.Western Blot (Tissue lysate)
PITX1 MaxPab rabbit polyclonal antibody. Western Blot analysis of PITX1 expression in human placenta.Western Blot (Transfected lysate)
Western Blot analysis of PITX1 expression in transfected 293T cell line (H00005307-T01) by PITX1 MaxPab polyclonal antibody.
Lane 1: PITX1 transfected lysate(34.10 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to PITX1 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — PITX1
Entrez GeneID
5307GeneBank Accession#
NM_002653.3Protein Accession#
NP_002644.3Gene Name
PITX1
Gene Alias
BFT, POTX, PTX1
Gene Description
paired-like homeodomain 1
Omim ID
602149Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. Members of this family are involved in organ development and left-right asymmetry. This protein acts as a transcriptional regulator involved in basal and hormone-regulated activity of prolactin. [provided by RefSeq
Other Designations
hindlimb expressed homeobox protein backfoot|paired-like homeodomain transcription factor 1|pituitary homeo box 1|pituitary otx-related factor
-
Interactome
-
Disease
-
Publication Reference
-
Trichostatin A inhibits skeletal muscle atrophy induced by cigarette smoke exposure in mice.
Ding J, Li F, Cong Y, Miao J, Wu D, Liu B, Wang L.
Life Sciences 2019 Oct; 235:116800.
Application:IHC-P, WB-Ti, Mouse, Muscle.
-
MicroRNA-1204 promotes cell proliferation by regulating PITX1 in non-small cell lung cancer.
Jiang W, He Y, Shi Y, Guo Z, Yang S, Wei K, Pan C, Xia Y, Chen Y.
Cell Biology International 2019 Mar; 43(3):253.
Application:IHC-P, WB, Human, Mouse, A-549, H1299 cells, Mouse tumors.
-
A Distal Modular Enhancer Complex Acts to Control Pituitary- and Nervous System-Specific Expression of the LHX3 Regulatory Gene.
Mullen RD, Park S, Rhodes SJ.
Molecular Endocrinology 2011 Dec; 26(2).
Application:ChIP, Mouse, Mouse αT3 pituitary cells.
-
Trichostatin A inhibits skeletal muscle atrophy induced by cigarette smoke exposure in mice.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com