Product Browser

Last updated: 2017/10/15
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PIK3CA monoclonal antibody (M01), clone 3G3

  • Catalog # : H00005290-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant PIK3CA.
  • Immunogen:
  • PIK3CA (NP_006209, 959 a.a. ~ 1068 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • DFLIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIAYIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged PIK3CA is approximately 1ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • In situ Proximity Ligation Assay (Cell)
  • <em>In situ</em> Proximity Ligation Assay (Cell)
  • Proximity Ligation Analysis of protein-protein interactions between APPL1 and PIK3CA. HeLa cells were stained with anti-APPL1 rabbit purified polyclonal 1:1200 and anti-PIK3CA mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
  • Application Image
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • In situ Proximity Ligation Assay (Cell)
  • <em>In situ</em> Proximity Ligation Assay (Cell)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 5290
  • Gene Name:
  • PIK3CA
  • Gene Alias:
  • MGC142161,MGC142163,PI3K,p110-alpha
  • Gene Description:
  • phosphoinositide-3-kinase, catalytic, alpha polypeptide
  • Gene Summary:
  • Phosphatidylinositol 3-kinase is composed of an 85 kDa regulatory subunit and a 110 kDa catalytic subunit. The protein encoded by this gene represents the catalytic subunit, which uses ATP to phosphorylate PtdIns, PtdIns4P and PtdIns(4,5)P2. This gene has been found to be oncogenic and has been implicated in cervical cancers. [provided by RefSeq
  • Other Designations:
  • PI3-kinase p110 subunit alpha,PtdIns-3-kinase p110,phosphatidylinositol 3-kinase, catalytic, 110-KD, alpha,phosphatidylinositol 3-kinase, catalytic, alpha polypeptide,phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit, alpha isoform
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook