Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PGK2 polyclonal antibody (A01)

  • Catalog # : H00005232-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant PGK2.
  • Immunogen:
  • PGK2 (NP_620061, 268 a.a. ~ 339 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • DIMAKAQKNGVRITFPVDFVTGDKFDENAQVGKATVASGISPGWMGLDCGPESNKNHAQVVAQARLIVWNGP
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00005232-A01
    Western Blot detection against Immunogen (34.03 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • PGK2 polyclonal antibody (A01), Lot # 051219JCO1 Western Blot analysis of PGK2 expression in Hela S3 NE ( Cat # L013V3 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5232
  • Gene Name:
  • PGK2
  • Gene Alias:
  • PGK-2,PGKB,PGKPS,dJ417L20.2
  • Gene Description:
  • phosphoglycerate kinase 2
  • Gene Summary:
  • The PGK2 gene encodes a testis-specific form of phosphoglycerate kinase (EC 2.7.2.3), which catalyzes the reversible conversion of 1,3-diphosphoglycerate to 3-phosphoglycerate during glycolysis, generating one molecule of ATP. See also PGK1 (MIM 311800), which is ubiquitously expressed in all somatic tissues and maps to chromosome Xq13.[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000016591,phosphoglycerate kinase 1, pseudogene 2,phosphoglycerate kinase autosomal pseudogene
  • RSS
  • YouTube
  • Linkedin
  • Facebook