PDK2 monoclonal antibody (M01), clone 2G1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant PDK2.
Immunogen
PDK2 (AAH05811, 187 a.a. ~ 276 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
HIGSIDPNCNVSEVVKDAYDMAKLLCDKYYMASPDLEIQEINAANSKQPIHMVYVPSHLYHMLFELFKNAMRATVESHESSLILPPIKVM
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (91); Rat (91)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.31 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PDK2 monoclonal antibody (M01), clone 2G1 Western Blot analysis of PDK2 expression in U-2 OS ( Cat # L022V1 ).Western Blot (Transfected lysate)
Western Blot analysis of PDK2 expression in transfected 293T cell line by PDK2 monoclonal antibody (M01), clone 2G1.
Lane 1: PDK2 transfected lysate(46.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to PDK2 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 0.8 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PDK2 is approximately 0.3ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of PDK2 over-expressed 293 cell line, cotransfected with PDK2 Validated Chimera RNAi ( Cat # H00005164-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PDK2 monoclonal antibody (M01) clone 2G1 (Cat # H00005164-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — PDK2
-
Interactomes
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com