PDK2 monoclonal antibody (M02), clone 5F8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
PDK2 monoclonal antibody (M02), clone 5F8. Western Blot analysis of PDK2 expression in 293 ( Cat # L026V1 ).
Western Blot (Cell lysate)
PDK2 monoclonal antibody (M02), clone 5F8. Western Blot analysis of PDK2 expression in A-431 ( Cat # L015V1 ).
Western Blot (Cell lysate)
PDK2 monoclonal antibody (M02), clone 5F8 Western Blot analysis of PDK2 expression in HeLa ( Cat # L013V1 ).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to PDK2 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 2 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PDK2 is approximately 0.03ng/ml as a capture antibody.
Western Blot detection against Immunogen (35.31 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PDK2.
Immunogen
PDK2 (AAH05811, 187 a.a. ~ 276 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
HIGSIDPNCNVSEVVKDAYDMAKLLCDKYYMASPDLEIQEINAANSKQPIHMVYVPSHLYHMLFELFKNAMRATVESHESSLILPPIKVM
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (91); Rat (91)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.31 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PDK2 monoclonal antibody (M02), clone 5F8. Western Blot analysis of PDK2 expression in 293 ( Cat # L026V1 ).Western Blot (Cell lysate)
PDK2 monoclonal antibody (M02), clone 5F8. Western Blot analysis of PDK2 expression in A-431 ( Cat # L015V1 ).Western Blot (Cell lysate)
PDK2 monoclonal antibody (M02), clone 5F8 Western Blot analysis of PDK2 expression in HeLa ( Cat # L013V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to PDK2 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 2 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PDK2 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — PDK2
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com