PDGFRA monoclonal antibody (M02), clone 4H1-1C9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant PDGFRA.
Immunogen
PDGFRA (AAH15186, 25 a.a. ~ 218 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LSLPSILPNENEKVVQLNSSFSLRCFGESEVSWQYPMSEEESSDVEIRNEENNSGLFVTVLEVSSASAAHTGLYTCYYNHTQTEENELEGRHIYIYVPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLHNSEGVVPASYDSRQGFNGTFTVGPYICEATVKGKKFQTIPFNVYALKGTCIISFLL
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (47.08 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between CRK and PDGFRA. HeLa cells were stained with anti-CRK rabbit purified polyclonal 1:1200 and anti-PDGFRA mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — PDGFRA
Entrez GeneID
5156GeneBank Accession#
BC015186Protein Accession#
AAH15186Gene Name
PDGFRA
Gene Alias
CD140A, MGC74795, PDGFR2, Rhe-PDGFRA
Gene Description
platelet-derived growth factor receptor, alpha polypeptide
Gene Ontology
HyperlinkGene Summary
This gene encodes a cell surface tyrosine kinase receptor for members of the platelet-derived growth factor family. These growth factors are mitogens for cells of mesenchymal origin. The identity of the growth factor bound to a receptor monomer determines whether the functional receptor is a homodimer or a heterodimer, composed of both platelet-derived growth factor receptor alpha and beta polypeptides. Studies in knockout mice, where homozygosity is lethal, indicate that the alpha form of the platelet-derived growth factor receptor is particularly important for kidney development since mice heterozygous for the receptor exhibit defective kidney phenotypes. [provided by RefSeq
Other Designations
FIP1L1/PDGFRA fusion protein|platelet-derived growth factor receptor alpha|rearranged-in-hypereosinophilia-platelet derived growth factor receptor alpha fusion protein
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Dicer1 and miR-219 Are Required for Normal Oligodendrocyte Differentiation and Myelination.
Dugas JC, Cuellar TL, Scholze A, Ason B, Ibrahim A, Emery B, Zamanian JL, Foo LC, McManus MT, Barres BA.
Neuron 2010 Mar; 65(5):597.
Application:WB-Tr, Mouse, Oligodendrocyte precursor cells.
-
Dicer1 and miR-219 Are Required for Normal Oligodendrocyte Differentiation and Myelination.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com