OCRL monoclonal antibody (M02), clone 4A6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
OCRL monoclonal antibody (M02), clone 4A6 Western Blot analysis of OCRL expression in Hela S3 NE ( Cat # L013V3 ).
Western Blot (Transfected lysate)
Western Blot analysis of OCRL expression in transfected 293T cell line by OCRL monoclonal antibody (M02), clone 4A6.
Lane 1: OCRL transfected lysate(103.2 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to OCRL on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged OCRL is approximately 0.1ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of OCRL over-expressed 293 cell line, cotransfected with OCRL Validated Chimera RNAi ( Cat # H00004952-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with OCRL monoclonal antibody (M02), clone 4A6 (Cat # H00004952-M02 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot detection against Immunogen (36.08 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant OCRL.
Immunogen
OCRL (NP_000267, 146 a.a. ~ 239 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SGLLGFEDNFSSMNLDKKINSQNQPTGIHREPPPPPFSVNKMLPREKEASNKEQPKVTNTMRKLFVPNTQSGQREGLIKHILAKREKEYVNIQT
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.08 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
OCRL monoclonal antibody (M02), clone 4A6 Western Blot analysis of OCRL expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Transfected lysate)
Western Blot analysis of OCRL expression in transfected 293T cell line by OCRL monoclonal antibody (M02), clone 4A6.
Lane 1: OCRL transfected lysate(103.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to OCRL on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged OCRL is approximately 0.1ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of OCRL over-expressed 293 cell line, cotransfected with OCRL Validated Chimera RNAi ( Cat # H00004952-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with OCRL monoclonal antibody (M02), clone 4A6 (Cat # H00004952-M02 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — OCRL
Entrez GeneID
4952GeneBank Accession#
NM_000276Protein Accession#
NP_000267Gene Name
OCRL
Gene Alias
INPP5F, LOCR, NPHL2, OCRL1
Gene Description
oculocerebrorenal syndrome of Lowe
Gene Ontology
HyperlinkGene Summary
This gene encodes a phosphatase enzyme that is involved in actin polymerization and is found in the trans-Golgi network. Mutations in this gene cause oculocerebrorenal syndrome of Lowe and also Dent disease. [provided by RefSeq
Other Designations
Lowe oculocerebrorenal syndrome protein|OTTHUMP00000024304|phosphatidylinositol polyphosphate 5-phosphatase
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com