Product Browser

Last updated: 2017/5/21
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NRF1 polyclonal antibody (A01)

  • Catalog # : H00004899-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant NRF1.
  • Immunogen:
  • NRF1 (NP_005002, 201 a.a. ~ 285 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • TQAQLRAFIPEMLKYSTGRGKPGWGKESCKPIWWPEDIPWANVRSDVRTEEQKQRVSWTQALRTIVKNCYKQHGREDLLYAFEDQ
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00004899-A01
    Western Blot detection against Immunogen (35.46 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • NRF1 polyclonal antibody (A01), Lot # ABNOVA060630QCS1 Western Blot analysis of NRF1 expression in Hela S3 NE ( Cat # L013V3 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 4899
  • Gene Name:
  • NRF1
  • Gene Alias:
  • ALPHA-PAL
  • Gene Description:
  • nuclear respiratory factor 1
  • Gene Summary:
  • This gene encodes a protein that homodimerizes and functions as a transcription factor which activates the expression of some key metabolic genes regulating cellular growth and nuclear genes required for respiration, heme biosynthesis, and mitochondrial DNA transcription and replication. The protein has also been associated with the regulation of neurite outgrowth. Alternate transcriptional splice variants, which encode the same protein, have been characterized. Additional variants encoding different protein isoforms have been described but they have not been fully characterized. Confusion has occurred in bibliographic databases due to the shared symbol of NRF1 for this gene and for "nuclear factor (erythroid-derived 2)-like 1" which has an official symbol of NFE2L1. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000184912,alpha palindromic-binding protein
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook