NOV (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Human NOV full-length ORF ( AAH15028, 1 a.a. - 357 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MQSVQSTSFCLRKQCLCLTFLLLHLLGQVAATQRCPPQCPGRCPATPPTCAPGVRAVLDGCSCCLVCARQRGESCSDLEPCDEGSGLYCDRSADPSKQTGICTAVEGDNCVFDGVIYRSGEKFQPSCKFQCTCRDGQIGCVPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDSLGGLTLAAYRPEATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFSTRVTNRNRQCEMLKQTRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKNCTSLHTYKPRFCGVCSDGRCCTPHNTKTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGKM
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
65.01
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — NOV
Entrez GeneID
4856GeneBank Accession#
BC015028Protein Accession#
AAH15028Gene Name
NOV
Gene Alias
CCN3, IGFBP9
Gene Description
nephroblastoma overexpressed gene
Omim ID
164958Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a small secreted cysteine-rich protein and a member of the CCN family of regulatory proteins. CNN family proteins associate with the extracellular matrix and play an important role in cardiovascular and skeletal development, fibrosis and cancer development. [provided by RefSeq
Other Designations
nephroblastoma overexpressed
-
Interactomes
-
Publication Reference
-
Roles of heterotypic CCN2/CTGF-CCN3/NOV and homotypic CCN2-CCN2 interactions in expression of the differentiated phenotype of chondrocytes.
Hoshijima M, Hattori T, Aoyama E, Nishida T, Yamashiro T, Takigawa M.
The FEBS Journal 2012 Oct; 279(19):3584.
Application:Func, PI, Recombinant protein.
-
Novel effects of CCN3 that may direct the differentiation of chondrocytes.
Janune D, Kubota S, Nishida T, Kawaki H, Perbal B, Iida S, Takigawa M.
FEBS Letters 2011 Oct; 585(19):3033.
Application:Func, Rat, Rat epiphyseal chondrocytes.
-
Roles of heterotypic CCN2/CTGF-CCN3/NOV and homotypic CCN2-CCN2 interactions in expression of the differentiated phenotype of chondrocytes.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com