Product Browser

Last updated: 2017/9/24
  • Related Product Showcase
  • By Research Area

  • By Disease

  • By Biomarker

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NME1 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00004830-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human NME1 protein.
  • Immunogen:
  • NME1 (ENSP00000337060, 1 a.a. ~ 177 a.a) full-length human protein.
  • Sequence:
  • MVLLSTLGIVFQGEGPPISSCDTGTMANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of NME1 expression in transfected 293T cell line (H00004830-T01) by NME1 MaxPab polyclonal antibody.

    Lane 1: NME1 transfected lysate(19.70 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 4830
  • Gene Name:
  • NME1
  • Gene Alias:
  • AWD,GAAD,NB,NBS,NDPK-A,NDPKA,NM23,NM23-H1
  • Gene Description:
  • non-metastatic cells 1, protein (NM23A) expressed in
  • Gene Summary:
  • This gene (NME1) was identified because of its reduced mRNA transcript levels in highly metastatic cells. Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A' (encoded by this gene) and 'B' (encoded by NME2) isoforms. Mutations in this gene have been identified in aggressive neuroblastomas. Two transcript variants encoding different isoforms have been found for this gene. Co-transcription of this gene and the neighboring downstream gene (NME2) generates naturally-occurring transcripts (NME1-NME2), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product. [provided by RefSeq
  • Other Designations:
  • NDP kinase A,OTTHUMP00000174772
  • RSS
  • YouTube
  • Linkedin
  • Facebook