NEU1 monoclonal antibody (M01), clone 3F9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
NEU1 monoclonal antibody (M01), clone 3F9. Western Blot analysis of NEU1 expression in Raw 264.7.
Western Blot (Cell lysate)
NEU1 monoclonal antibody (M01), clone 3F9. Western Blot analysis of NEU1 expression in IMR-32.
Western Blot (Cell lysate)
NEU1 monoclonal antibody (M01), clone 3F9. Western Blot analysis of NEU1 expression in PC-12.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NEU1 is 0.03 ng/ml as a capture antibody.
Western Blot detection against Immunogen (34.76 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant NEU1.
Immunogen
NEU1 (NP_000425, 334 a.a. ~ 415 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
NPAHPEFRVNLTLRWSFSNGTSWRKETVQLWPGPSGYSSLATLEGSMDGEEQAPQLYVLYEKGRNHYTESISVAKISVYGTL
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Rat (82)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (34.76 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
NEU1 monoclonal antibody (M01), clone 3F9. Western Blot analysis of NEU1 expression in Raw 264.7.Western Blot (Cell lysate)
NEU1 monoclonal antibody (M01), clone 3F9. Western Blot analysis of NEU1 expression in IMR-32.Western Blot (Cell lysate)
NEU1 monoclonal antibody (M01), clone 3F9. Western Blot analysis of NEU1 expression in PC-12.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NEU1 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — NEU1
Entrez GeneID
4758GeneBank Accession#
NM_000434Protein Accession#
NP_000425Gene Name
NEU1
Gene Alias
FLJ93471, NANH, NEU, SIAL1
Gene Description
sialidase 1 (lysosomal sialidase)
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a lysosomal enzyme that cleaves terminal sialic acid residues from substrates such as glycoproteins and glycolipids. In the lysosome, this enzyme is part of a heterotrimeric complex together with beta-galactosidase and cathepsin A (the latter is also referred to as 'protective protein'). Mutations in this gene can lead to sialidosis, a lysosomal storage disease that can be type 1 (cherry red spot-myoclonus syndrome or normosomatic type), which is late-onset, or type 2 (the dysmorphic type), which occurs at an earlier age with increased severity. [provided by RefSeq
Other Designations
G9 sialidase|N-acetyl-alpha-neuraminidase 1|OTTHUMP00000029419|acetylneuraminyl hydrolase|exo-alpha-sialidase|lysosomal sialidase|neuraminidase
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com