Product Browser

Last updated: 2017/9/17
  • Related Product Showcase
  • By Research Area

  • By Disease

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NDUFB7 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00004713-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human NDUFB7 protein.
  • Immunogen:
  • NDUFB7 (NP_004137.2, 1 a.a. ~ 137 a.a) full-length human protein.
  • Sequence:
  • MGAHLVRRYLGDASVEPDPLQMPTFPPDYGFPERKEREMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKAAELAKGQGPGEVDPKVAL
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of NDUFB7 expression in transfected 293T cell line (H00004713-T01) by NDUFB7 MaxPab polyclonal antibody.

    Lane 1: NDUFB7 transfected lysate(16.40 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 4713
  • Gene Name:
  • NDUFB7
  • Gene Alias:
  • B18,CI-B18,MGC2480
  • Gene Description:
  • NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7, 18kDa
  • Gene Summary:
  • The protein encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. It is located at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. [provided by RefSeq
  • Other Designations:
  • NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7 (18kD, B18),NADH-ubiquinone oxidoreductase B18 subunit
  • RSS
  • YouTube
  • Linkedin
  • Facebook