NDUFB7 monoclonal antibody (M01), clone 4D4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant NDUFB7.
Immunogen
NDUFB7 (NP_004137, 38 a.a. ~ 137 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKAAELAKGQGPGEVDPKVAL
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
NDUFB7 monoclonal antibody (M01), clone 4D4 Western Blot analysis of NDUFB7 expression in A-431 ( Cat # L015V1 ).Western Blot (Transfected lysate)
Western Blot analysis of NDUFB7 expression in transfected 293T cell line by NDUFB7 monoclonal antibody (M01), clone 4D4.
Lane 1: NDUFB7 transfected lysate(16.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NDUFB7 is approximately 1ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of NDUFB7 over-expressed 293 cell line, cotransfected with NDUFB7 Validated Chimera RNAi ( Cat # H00004713-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with NDUFB7 monoclonal antibody (M01), clone 4D4 (Cat # H00004713-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — NDUFB7
Entrez GeneID
4713GeneBank Accession#
NM_004146Protein Accession#
NP_004137Gene Name
NDUFB7
Gene Alias
B18, CI-B18, MGC2480
Gene Description
NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7, 18kDa
Omim ID
603842Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. It is located at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. [provided by RefSeq
Other Designations
NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7 (18kD, B18)|NADH-ubiquinone oxidoreductase B18 subunit
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com