Product Browser

Last updated: 2017/1/15
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NDUFA1 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00004694-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human NDUFA1 protein.
  • Immunogen:
  • NDUFA1 (AAH00266.1, 1 a.a. ~ 70 a.a) full-length human protein.
  • Sequence:
  • MWFEILPGLSVMGVCLLIPGLATAYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKGLENID
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of NDUFA1 expression in transfected 293T cell line (H00004694-T02) by NDUFA1 MaxPab polyclonal antibody.

    Lane 1: NDUFA1 transfected lysate(8.10 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 4694
  • Gene Name:
  • NDUFA1
  • Gene Alias:
  • CI-MWFE,MWFE,ZNF183
  • Gene Description:
  • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1, 7.5kDa
  • Gene Summary:
  • The human NDUFA1 gene codes for an essential component of complex I of the respiratory chain, which transfers electrons from NADH to ubiquinone. It has been noted that the N-terminal hydrophobic domain has the potential to be folded into an alpha-helix spanning the inner mitochondrial membrane with a C-terminal hydrophilic domain interacting with globular subunits of complex I. The highly conserved two-domain structure suggests that this feature is critical for the protein function and might act as an anchor for the NADH:ubiquinone oxidoreductase complex at the inner mitochondrial membrane. However, the NDUFA1 peptide is one of about 31 components of the "hydrophobic protein" (HP) fraction of complex I which is involved in proton translocation. Thus the NDUFA1 peptide may also participate in that function. [provided by RefSeq
  • Other Designations:
  • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1,NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1 (7.5kD, MWFE),NADH oxidoreductase subunit MWFE,NADH:ubiquinone oxidoreductase (complex 1),OTTHUMP00000023930,type I dehydrogenase
  • RSS
  • YouTube
  • Linkedin
  • Facebook