Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NBL1 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00004681-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human NBL1 protein.
  • Immunogen:
  • NBL1 (NP_005371.1, 1 a.a. ~ 180 a.a) full-length human protein.
  • Sequence:
  • MLRVLVGAVLPAMLLAAPPPINKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSYSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKILHCSCQACGKEPSHEGLSVYVQGEDGPGSQPGTHPHPHPHPHPGGQTPEPEDPPGAPHTEEEGAED
  • Host:
  • Rabbit
  • Reactivity:
  • Human, Mouse
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • NBL1 MaxPab rabbit polyclonal antibody. Western Blot analysis of NBL1 expression in human colon.
  • PDF DownloadProtocol Download
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • NBL1 MaxPab rabbit polyclonal antibody. Western Blot analysis of NBL1 expression in mouse lung.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of NBL1 expression in transfected 293T cell line (H00004681-T01) by NBL1 MaxPab polyclonal antibody.

    Lane 1: NBL1 transfected lysate(19.30 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 4681
  • Gene Name:
  • NBL1
  • Gene Alias:
  • D1S1733E,DAN,DAND1,MGC8972,NB,NO3
  • Gene Description:
  • neuroblastoma, suppression of tumorigenicity 1
  • Gene Summary:
  • This gene product is the founding member of the evolutionarily conserved CAN (Cerberus and DAN) family of proteins, which contain a domain resembling the CTCK (C-terminal cystine knot-like) motif found in a number of signaling molecules. These proteins are secreted, and act as BMP (bone morphogenetic protein) antagonists by binding to BMPs and preventing them from interacting with their receptors. They may thus play an important role during growth and development. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq
  • Other Designations:
  • differential screening-selected gene aberrant in neuroblastoma,neuroblastoma candidate region, suppression of tumorigenicity 1,neuroblastoma suppressor of tumorigenicity 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook