Product Browser

Last updated: 2017/8/13

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MYL4 (Human) Recombinant Protein (P01)

  • Catalog # : H00004635-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human MYL4 full-length ORF ( AAH30228, 1 a.a. - 197 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MAPKKPEPKKEAAKPAPAPAPAPAPAPAPAPEAPKEPAFDPKSVKIDFTADQIEEFKEAFSLFDRTPTGEMKITYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMNVKMLDFETFLPILQHISRNKEQGTYEDFVEGLRVFDKESNGTVMGAELRHVLATLGEKMTEAEVEQLLAGQEDANGCINYEAFVKHIMSG
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 47.41
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00004635-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 4635
  • Gene Name:
  • MYL4
  • Gene Alias:
  • ALC1,AMLC,GT1,PRO1957
  • Gene Description:
  • myosin, light chain 4, alkali; atrial, embryonic
  • Gene Summary:
  • Myosin is a hexameric ATPase cellular motor protein. It is composed of two myosin heavy chains, two nonphosphorylatable myosin alkali light chains, and two phosphorylatable myosin regulatory light chains. This gene encodes a myosin alkali light chain that is found in embryonic muscle and adult atria. Two alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
  • Other Designations:
  • atrial/embryonic alkali myosin light chain,myosin, atrial/fetal muscle, light chain,myosin, light polypeptide 4, alkali; atrial, embryonic
  • RSS
  • YouTube
  • Linkedin
  • Facebook