Product Browser

Last updated: 2014/10/27
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MYC monoclonal antibody (M02), clone 1G7

  • Catalog # : H00004609-M02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant MYC.
  • Immunogen:
  • MYC (NP_002458, 330 a.a. ~ 439 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • VRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG3 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00004609-M02
    Western Blot detection against Immunogen (37.84 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of MYC expression in transfected 293T cell line by MYC monoclonal antibody (M02), clone 1G7.

    Lane 1: MYC transfected lysate(49.561 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) enlargeenlarge this image
  • Immunoperoxidase of monoclonal antibody to MYC on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]
  • Protocol Download
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescence of monoclonal antibody to MYC on HeLa cell. [antibody concentration 10 ug/ml]
  • Protocol Download
  • ELISA
  • Immunofluorescence (Circulating Tumor Cell)
  • Immunofluorescence (Circulating Tumor Cell)
  • HeLa cells were stained with MYC-FITC labeled monoclonal antibody (Green). The cell nucleus were counterstained with DAPI (Blue).
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • ELISA
  • Immunofluorescence (Circulating Tumor Cell)
  • Immunofluorescence (Circulating Tumor Cell)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 4609
  • Gene Name:
  • MYC
  • Gene Alias:
  • bHLHe39,c-Myc
  • Gene Description:
  • v-myc myelocytomatosis viral oncogene homolog (avian)
  • Gene Summary:
  • The protein encoded by this gene is a multifunctional, nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. It functions as a transcription factor that regulates transcription of specific target genes. Mutations, overexpression, rearrangement and translocation of this gene have been associated with a variety of hematopoietic tumors, leukemias and lymphomas, including Burkitt lymphoma. There is evidence to show that alternative translation initiations from an upstream, in-frame non-AUG (CUG) and a downstream AUG start site result in the production of two isoforms with distinct N-termini. The synthesis of non-AUG initiated protein is suppressed in Burkitt's lymphomas, suggesting its importance in the normal function of this gene. [provided by RefSeq
  • Other Designations:
  • avian myelocytomatosis viral oncogene homolog,myc proto-oncogene protein,v-myc avian myelocytomatosis viral oncogene homolog
  • RSS
  • YouTube
  • Linkedin
  • Facebook