Product Browser

Last updated: 2019/8/18

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MTAP monoclonal antibody (M01J), clone 2G4 CX Grade

  • Catalog # : H00004507-M01J
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full-length recombinant MTAP.
  • Immunogen:
  • MTAP (AAH18625, 1 a.a. ~ 154 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCILLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDSHVRRACFPFTFHHDCFQRPPQKPSRSHCVSCATCRTMS
  • Host:
  • Mouse
  • Reactivity:
  • Human, Mouse, Rat
  • Isotype:
  • IgG1 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00004507-M01J
    Western Blot detection against Immunogen (42.68 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Immunofluorescence
  • Immunofluorescence enlargeenlarge this image
  • Immunofluorescence of monoclonal antibody to MTAP on HeLa cell . [antibody concentration 10 ug/ml]
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 4507
  • Gene Name:
  • MTAP
  • Gene Alias:
  • MSAP,c86fus
  • Gene Description:
  • methylthioadenosine phosphorylase
  • Gene Summary:
  • This gene encodes an enzyme that plays a major role in polyamine metabolism and is important for the salvage of both adenine and methionine. The encoded enzyme is deficient in many cancers because this gene and the tumor suppressor p16 gene are co-deleted. Multiple alternatively spliced transcript variants have been described for this gene, but their full-length natures remain unknown. [provided by RefSeq
  • Other Designations:
  • 5'-methylthioadenosine phosphorylase,MeSAdo phosphorylase,OTTHUMP00000021152
  • RSS
  • YouTube
  • Linkedin
  • Facebook