TNFRSF9 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human TNFRSF9 partial ORF ( AAH06196, 87 a.a. - 186 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
DCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.63
Interspecies Antigen Sequence
Mouse (64); Rat (61)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — TNFRSF9
Entrez GeneID
3604GeneBank Accession#
BC006196Protein Accession#
AAH06196Gene Name
TNFRSF9
Gene Alias
4-1BB, CD137, CDw137, ILA, MGC2172
Gene Description
tumor necrosis factor receptor superfamily, member 9
Omim ID
602250Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contributes to the clonal expansion, survival, and development of T cells. It can also induce proliferation in peripheral monocytes, enhance T cell apoptosis induced by TCR/CD3 triggered activation, and regulate CD28 co-stimulation to promote Th1 cell responses. The expression of this receptor is induced by lymphocyte activation. TRAF adaptor proteins have been shown to bind to this receptor and transduce the signals leading to activation of NF-kappaB. [provided by RefSeq
Other Designations
4-1BB ligand receptor|CD137 antigen|OTTHUMP00000001360|OTTHUMP00000044294|T cell antigen ILA|homolog of mouse 4-1BB|induced by lymphocyte activation (ILA)|interleukin-activated receptor, homolog of mouse Ly63|receptor protein 4-1BB
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com