IL3RA purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of IL3RA expression in transfected 293T cell line (H00003563-T01) by IL3RA MaxPab polyclonal antibody.
Lane 1: IL3RA transfected lysate(43.30 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human IL3RA protein.
Immunogen
IL3RA (NP_002174.1, 1 a.a. ~ 378 a.a) full-length human protein.
Sequence
MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAGKAGLEECLVTEVQVVQKT
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (31); Rat (31)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of IL3RA expression in transfected 293T cell line (H00003563-T01) by IL3RA MaxPab polyclonal antibody.
Lane 1: IL3RA transfected lysate(43.30 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — IL3RA
Entrez GeneID
3563GeneBank Accession#
NM_002183.2Protein Accession#
NP_002174.1Gene Name
IL3RA
Gene Alias
CD123, IL3R, IL3RAY, IL3RX, IL3RY, MGC34174, hIL-3Ra
Gene Description
interleukin 3 receptor, alpha (low affinity)
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is an interleukin 3 specific subunit of a heterodimeric cytokine receptor. The receptor is comprised of a ligand specific alpha subunit and a signal transducing beta subunit shared by the receptors for interleukin 3 (IL3), colony stimulating factor 2 (CSF2/GM-CSF), and interleukin 5 (IL5). The binding of this protein to IL3 depends on the beta subunit. The beta subunit is activated by the ligand binding, and is required for the biological activities of IL3. This gene and the gene encoding the colony stimulating factor 2 receptor alpha chain (CSF2RA) form a cytokine receptor gene cluster in a X-Y pseudoautosomal region on chromosomes X or Y. [provided by RefSeq
Other Designations
CD123 antigen|Interleukin-3 receptor|OTTHUMP00000022828|interleukin 3 receptor, alpha
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com