HNF4A monoclonal antibody (M04J), clone 4E2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
HNF4A monoclonal antibody (M04J), clone 4E2. Western Blot analysis of HNF4A expression in HepG2.
Western Blot (Transfected lysate)
Western Blot analysis of HNF4A expression in transfected 293T cell line by HNF4A monoclonal antibody (M04J), clone 4E2.
Lane 1: HNF4A transfected lysate (Predicted MW: 51.6 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HNF4A is 0.3 ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of HNF4A over-expressed 293 cell line, cotransfected with HNF4A Validated Chimera RNAi ( Cat # H00003172-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with HNF4A monoclonal antibody (M04), clone 4E2 (Cat # H00003172-M04 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Immunofluorescence
Immunofluorescence of monoclonal antibody to HNF4A on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant HNF4A.
This product is belong to Cell Culture Grade Antibody (CX Grade).Immunogen
HNF4A (NP_000448.3, 324 a.a. ~ 423 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
NDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQEMLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMCEWPRP
Host
Mouse
Reactivity
Human
Preparation Method
Cell Culture Production
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
HNF4A monoclonal antibody (M04J), clone 4E2. Western Blot analysis of HNF4A expression in HepG2.Western Blot (Transfected lysate)
Western Blot analysis of HNF4A expression in transfected 293T cell line by HNF4A monoclonal antibody (M04J), clone 4E2.
Lane 1: HNF4A transfected lysate (Predicted MW: 51.6 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HNF4A is 0.3 ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of HNF4A over-expressed 293 cell line, cotransfected with HNF4A Validated Chimera RNAi ( Cat # H00003172-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with HNF4A monoclonal antibody (M04), clone 4E2 (Cat # H00003172-M04 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to HNF4A on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — HNF4A
Entrez GeneID
3172GeneBank Accession#
NM_000457.4Protein Accession#
NP_000448.3Gene Name
HNF4A
Gene Alias
FLJ39654, HNF4, HNF4a7, HNF4a8, HNF4a9, MODY, MODY1, NR2A1, NR2A21, TCF, TCF14
Gene Description
hepatocyte nuclear factor 4, alpha
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a nuclear transcription factor which binds DNA as a homodimer. The encoded protein controls the expression of several genes, including hepatocyte nuclear factor 1 alpha, a transcription factor which regulates the expression of several hepatic genes. This gene may play a role in development of the liver, kidney, and intestines. Mutations in this gene have been associated with monogenic autosomal dominant non-insulin-dependent diabetes mellitus type I. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq
Other Designations
HNF4-alpha|OTTHUMP00000031060|OTTHUMP00000031062|hepatic nuclear factor 4 alpha|hepatocyte nuclear factor 4 alpha|transcription factor-14
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com