HK2 monoclonal antibody (M01), clone 4H1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant HK2.
Immunogen
HK2 (AAH21116, 818 a.a. ~ 917 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
IVKEVCTVVARRAAQLCGAGMAAVVDRIRENRGLDALKVTVGVDGTLYKLHPHFAKVMHETVKDLAPKCDVSFLQSEDGSGKGAALITAVACRIREAGQR
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Rat (96)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
HK2 monoclonal antibody (M01), clone 4H1. Western Blot analysis of HK2 expression in PC-12(Cat # L012V1 ).Western Blot (Cell lysate)
HK2 monoclonal antibody (M01), clone 4H1. Western Blot analysis of HK2 expression in A-431 ( Cat # L015V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HK2 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — HK2
Entrez GeneID
3099GeneBank Accession#
BC021116Protein Accession#
AAH21116Gene Name
HK2
Gene Alias
DKFZp686M1669, HKII, HXK2
Gene Description
hexokinase 2
Omim ID
601125Gene Ontology
HyperlinkGene Summary
Hexokinases phosphorylate glucose to produce glucose-6-phosphate, the first step in most glucose metabolism pathways. This gene encodes hexokinase 2, the predominant form found in skeletal muscle. It localizes to the outer membrane of mitochondria. Expression of this gene is insulin-responsive, and studies in rat suggest that it is involved in the increased rate of glycolysis seen in rapidly growing cancer cells. [provided by RefSeq
Other Designations
hexokinase-2, muscle
-
Interactomes
-
Pathways
- Amino sugar and nucleotide sugar metabolism
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Fructose and mannose metabolism
+ View More Disease
-
Publication Reference
-
Hindering NAT8L expression in hepatocellular carcinoma increases cytosolic aspartate delivery that fosters pentose phosphate pathway and purine biosynthesis promoting cell proliferation.
Pamela De Falco, Giacomo Lazzarino, Federica Felice, Enrico Desideri, Serena Castelli, Illari Salvatori, Fabio Ciccarone, Maria Rosa Ciriolo.
Redox Biology 2023 Feb; 59:102585.
Application:WB-Ce, Human, HepG2 cells.
-
Adaptive antioxidant response to mitochondrial fatty acid oxidation determines the proliferative outcome of cancer cells.
Serena Castelli, Fabio Ciccarone, Pamela De Falco, Maria Rosa Ciriolo.
Cancer Letters 2022 Feb; 554:216010.
Application:WB-Ce, Human, HeLa cells.
-
ROS-dependent HIF1α activation under forced lipid catabolism entails glycolysis and mitophagy as mediators of higher proliferation rate in cervical cancer cells.
Serena Castelli, Fabio Ciccarone, Daniela Tavian, Maria Rosa Ciriolo.
Journal of Experimental & Clinical Cancer Research 2021 Mar; 40(1):94.
Application:WB-Tr, Human, HeLa cells.
-
Expression and role in glycolysis of human ADP-dependent glucokinase.
Richter S, Richter JP, Mehta SY, Gribble AM, Sutherland-Smith AJ, Stowell KM, Print CG, Ronimus RS, Wilson WR.
Molecular and Cellular Biochemistry 2012 Jan; 364(1-2):131.
Application:WB, Human, SiHa, C33A, H460, H1299, A549, HT29, HCT116, MDA231, MiaPaca2, A2780, PC3, 22Rv1, HepG2, SCOV3, HCT8,A431, Panc01, H522, Hep3B, Dl145, FaDu, H69, H82.
-
Hindering NAT8L expression in hepatocellular carcinoma increases cytosolic aspartate delivery that fosters pentose phosphate pathway and purine biosynthesis promoting cell proliferation.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com